PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g096380.3
Common NameMTR_2g096380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 174aa    MW: 20020.1 Da    PI: 4.9568
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g096380.3genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding482.8e-15243548
                     -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     T+ E+ l +++  ++G++ W++Iar+++ gRt++++k++w++++
  Medtr2g096380.3  2 TPHEERLVLELQSKWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 43
                     9*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001673.12E-11143No hitNo description
PROSITE profilePS5129423.757147IPR017930Myb domain
SMARTSM007171.2E-10145IPR001005SANT/Myb domain
PfamPF002499.1E-13242IPR001005SANT/Myb domain
SuperFamilySSF466894.52E-12248IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.6E-19244IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MTPHEERLVL ELQSKWGNRW SRIARKLPGR TDNEIKNYWR THMRKKAQDK KRGSIQSTEH  60
HVMNSHASKE AGEESFYDTG GSSTSTQVKL VGEEHEKEIS MDDIWKDIDL SEENSLQNEE  120
CCNINNNISC LPKTSSSWEY NSTDSLWVMG EESMLFPMAP MSDDPYFSGY ANY*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.5330.0leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1484630.0BT148463.1 Medicago truncatula clone JCVI-FLMt-16I9 unknown mRNA.
GenBankBT1495760.0BT149576.1 Medicago truncatula clone JCVI-FLMt-17K5 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003597327.11e-128myb transcription factor
RefseqXP_003597328.21e-128myb transcription factor
SwissprotQ9LX821e-39MYB48_ARATH; Transcription factor MYB48
TrEMBLG7IHL51e-128G7IHL5_MEDTR; Myb transcription factor
TrEMBLG7IHL61e-128G7IHL6_MEDTR; Myb transcription factor
STRINGGLYMA15G04620.15e-59(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.23e-42myb domain protein 48
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]